MBP Antikörper (Middle Region)

Produktnummer ABIN630897

Produktdetails anti-MBP Antikörper

Target: MBP (Myelin Basic Protein (MBP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MBP antibody was raised against the middle region of MBP

Aufreinigung: Affinity purified

Immunogen: MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBP Blocking Peptide, catalog no. 33R-2945, is also available for use as a blocking control in assays to test for specificity of this MBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBP

Target: MBP (Myelin Basic Protein (MBP))

Andere Bezeichnung: Myelin basic protein (MBP Produkte)

Synonyme: C76307 antikoerper, Hmbpr antikoerper, R75289 antikoerper, golli-mbp antikoerper, mld antikoerper, shi antikoerper, Mbps antikoerper, cb274 antikoerper, fj33b11 antikoerper, mbp antikoerper, wu:fj33b11 antikoerper, wu:fq15b02 antikoerper, zgc:136630 antikoerper, MGC115135 antikoerper, myelin basic protein antikoerper, myelin basic protein a antikoerper, myelin basic protein L homeolog antikoerper, MBP antikoerper, Mbp antikoerper, mbpa antikoerper, mbp antikoerper, mbp.L antikoerper

Hintergrund: The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.

Molekulargewicht: 33 kDa (MW of target protein)