EEF2 Antikörper (N-Term)

Produktnummer ABIN630891

Dieses Anti-EEF2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EEF2 in WB. Geeignet für Human, Maus, Ratte, Drosophila melanogaster und C. elegans.

Kurzübersicht für EEF2 Antikörper (N-Term) (ABIN630891)

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EEF2 Antikörper

Bindungsspezifität: N-Term

Spezifität: EEF2 antibody was raised against the N terminal of EEF2

Aufreinigung: Affinity purified

Immunogen: EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF2 Blocking Peptide, (ABIN5613309), is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Andere Bezeichnung: EEF2

Hintergrund: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Molekulargewicht: 94 kDa (MW of target protein)

Pathways: AMPK Signaling