NMT1 Antikörper (N-Term)

Produktnummer ABIN630887

Der Kaninchen Polyklonal Anti-NMT1-Antikörper wurde für WB validiert. Er ist geeignet, NMT1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für NMT1 Antikörper (N-Term) (ABIN630887)

Target: NMT1 (N-Myristoyltransferase 1 (NMT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NMT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NMT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NMT1 antibody was raised against the N terminal of NMT1

Aufreinigung: Affinity purified

Immunogen: NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NMT1 Blocking Peptide, (ABIN5615012), is also available for use as a blocking control in assays to test for specificity of this NMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NMT1

Target: NMT1 (N-Myristoyltransferase 1 (NMT1))

Andere Bezeichnung: NMT1

Hintergrund: Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1).

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling