PPAT Antikörper (C-Term)
-
- Target Alle PPAT Antikörper anzeigen
- PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPAT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PPAT antibody was raised against the C terminal of PPAT
- Aufreinigung
- Affinity purified
- Immunogen
- PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
- Top Product
- Discover our top product PPAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPAT Blocking Peptide, catalog no. 33R-7523, is also available for use as a blocking control in assays to test for specificity of this PPAT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))
- Andere Bezeichnung
- PPAT (PPAT Produkte)
- Hintergrund
- PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.
- Molekulargewicht
- 56 kDa (MW of target protein)
-