PPAT Antikörper (N-Term)

Produktnummer ABIN630652

Produktdetails anti-PPAT Antikörper

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PPAT antibody was raised against the N terminal of PPAT

Aufreinigung: Affinity purified

Immunogen: PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPAT Blocking Peptide, catalog no. 33R-9857, is also available for use as a blocking control in assays to test for specificity of this PPAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPAT

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Andere Bezeichnung: PPAT (PPAT Produkte)

Synonyme: ATASE antikoerper, GPAT antikoerper, PRAT antikoerper, Atase antikoerper, 5730454C12Rik antikoerper, AA408689 antikoerper, AA675351 antikoerper, AI507113 antikoerper, C79945 antikoerper, im:6894693 antikoerper, si:dkeyp-117h8.5 antikoerper, wu:fb61f03 antikoerper, wu:fc28b09 antikoerper, phosphoribosyl pyrophosphate amidotransferase antikoerper, phosphoribosyl pyrophosphate amidotransferase L homeolog antikoerper, PPAT antikoerper, Ppat antikoerper, ppat.L antikoerper, ppat antikoerper

Hintergrund: PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Molekulargewicht: 56 kDa (MW of target protein)