DNMT3B Antikörper

Produktnummer ABIN630856

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DNMT3B in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für DNMT3B Antikörper (ABIN630856)

Target: DNMT3B (DNA (Cytosine-5-)-Methyltransferase 3 beta (DNMT3B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNMT3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNMT3B Antikörper

Aufreinigung: Affinity purified

Immunogen: DNMT3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNMT3B Blocking Peptide, (ABIN938993), is also available for use as a blocking control in assays to test for specificity of this DNMT3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNMT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNMT3B

Target: DNMT3B (DNA (Cytosine-5-)-Methyltransferase 3 beta (DNMT3B))

Andere Bezeichnung: DNMT3B

Hintergrund: DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Molekulargewicht: 86 kDa (MW of target protein)