TGIF1 Antikörper (C-Term)

Produktnummer ABIN630855

Produktdetails anti-TGIF1 Antikörper

Target: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGIF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TGIF1 antibody was raised against the C terminal of TGIF1

Aufreinigung: Affinity purified

Immunogen: TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGIF1 Blocking Peptide, catalog no. 33R-3506, is also available for use as a blocking control in assays to test for specificity of this TGIF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGIF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGIF1

Target: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Andere Bezeichnung: TGIF1 (TGIF1 Produkte)

Synonyme: HPE4 antikoerper, TGIF antikoerper, AA959811 antikoerper, AI462167 antikoerper, Tgif antikoerper, Tfig antikoerper, fa06h05 antikoerper, fb33g11 antikoerper, zgc:55852 antikoerper, wu:fa06h05 antikoerper, wu:fb33g11 antikoerper, hpe4 antikoerper, tgif antikoerper, tgif1 antikoerper, TGFB induced factor homeobox 1 antikoerper, TGFB-induced factor homeobox 1 antikoerper, TGFB induced factor homeobox 1 S homeolog antikoerper, TGIF1 antikoerper, Tgif1 antikoerper, tgif1 antikoerper, tgif1.S antikoerper

Hintergrund: TGIF1 is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Chromatin Binding, Tube Formation