STUB1 Antikörper (N-Term)

Produktnummer ABIN630820

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch STUB1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für STUB1 Antikörper (N-Term) (ABIN630820)

Target: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STUB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STUB1 Antikörper

Bindungsspezifität: N-Term

Spezifität: STUB1 antibody was raised against the N terminal of STUB1

Aufreinigung: Affinity purified

Immunogen: STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STUB1 Blocking Peptide, (ABIN5616448), is also available for use as a blocking control in assays to test for specificity of this STUB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STUB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STUB1

Target: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Andere Bezeichnung: STUB1

Hintergrund: STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Response to Water Deprivation