Dnmt2 Antikörper (N-Term)

Produktnummer ABIN630813

Dieses Anti-Dnmt2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Dnmt2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Dnmt2 Antikörper (N-Term) (ABIN630813)

Target: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Dnmt2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Dnmt2 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRDMT1 antibody was raised against the N terminal of TRDMT1

Aufreinigung: Affinity purified

Immunogen: TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRDMT1 Blocking Peptide, (ABIN5616769), is also available for use as a blocking control in assays to test for specificity of this TRDMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRDMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Dnmt2

Target: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Andere Bezeichnung: TRDMT1

Hintergrund: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity.

Molekulargewicht: 44 kDa (MW of target protein)