DAAM1 Antikörper (Middle Region)

Produktnummer ABIN630809

Der Kaninchen Polyklonal Anti-DAAM1-Antikörper wurde für WB validiert. Er ist geeignet, DAAM1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für DAAM1 Antikörper (Middle Region) (ABIN630809)

Target: DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAAM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DAAM1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DAAM1 antibody was raised against the middle region of DAAM1

Aufreinigung: Affinity purified

Immunogen: DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAAM1 Blocking Peptide, (ABIN938846), is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAAM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAAM1

Target: DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))

Andere Bezeichnung: DAAM1

Hintergrund: The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.

Molekulargewicht: 123 kDa (MW of target protein)

Pathways: WNT Signalweg