NEK7 Antikörper

Produktnummer ABIN630802

Produktdetails anti-NEK7 Antikörper

Target: NEK7

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEK7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEK7 Blocking Peptide, catalog no. 33R-4257, is also available for use as a blocking control in assays to test for specificity of this NEK7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEK7

Target: NEK7

Andere Bezeichnung: NEK7 (NEK7 Produkte)

Synonyme: 2810460C19Rik antikoerper, AU020186 antikoerper, wu:fj68f02 antikoerper, zgc:100962 antikoerper, zgc:92175 antikoerper, AtNek7 antikoerper, NIMA-related kinase 7 antikoerper, NIMA (never in mitosis gene a)-related expressed kinase 7 antikoerper, NIMA-related kinase 7 antikoerper, NIMA related kinase 7 antikoerper, NIMA-related kinase 7 S homeolog antikoerper, Nek7 antikoerper, nek7 antikoerper, NEK7 antikoerper, nek7.S antikoerper

Hintergrund: NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Inflammasome