HBXIP Antikörper (N-Term)

Produktnummer ABIN630790

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HBXIP in WB. Er zeigt eine Reaktivität gegenüber Hepatitis B Virus (HBV).

Kurzübersicht für HBXIP Antikörper (N-Term) (ABIN630790)

Target: HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))

Reaktivität: Hepatitis B Virus (HBV)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HBXIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HBXIP Antikörper

Bindungsspezifität: N-Term

Spezifität: HBXIP antibody was raised against the N terminal of HBXIP

Aufreinigung: Affinity purified

Immunogen: HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HBXIP Blocking Peptide, (ABIN938018), is also available for use as a blocking control in assays to test for specificity of this HBXIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBXIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HBXIP

Target: HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))

Substanzklasse: Viral Protein

Hintergrund: HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, Regulation of Cell Size