Myosin IC Antikörper (N-Term)

Produktnummer ABIN630755

Der Kaninchen Polyklonal Anti-Myosin IC-Antikörper wurde für WB validiert. Er ist geeignet, Myosin IC in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für Myosin IC Antikörper (N-Term) (ABIN630755)

Target: Myosin IC (MYO1C)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Myosin IC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Myosin IC Antikörper

Bindungsspezifität: N-Term

Spezifität: Myosin Ic antibody was raised against the N terminal of MYO1 C

Aufreinigung: Affinity purified

Immunogen: Myosin Ic antibody was raised using the N terminal of MYO1 C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Myosin Ic Blocking Peptide, (ABIN5614900), is also available for use as a blocking control in assays to test for specificity of this Myosin Ic antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Myosin IC

Target: Myosin IC (MYO1C)

Andere Bezeichnung: Myosin Ic

Hintergrund: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.

Molekulargewicht: 113 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling