NSUN2 Antikörper (C-Term)

Produktnummer ABIN630733

Produktdetails anti-NSUN2 Antikörper

Target: NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSUN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NSUN2 antibody was raised against the C terminal of NSUN2

Aufreinigung: Affinity purified

Immunogen: NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSUN2 Blocking Peptide, catalog no. 33R-2934, is also available for use as a blocking control in assays to test for specificity of this NSUN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSUN2

Target: NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))

Andere Bezeichnung: NSUN2 (NSUN2 Produkte)

Synonyme: D13Wsu123e antikoerper, Misu antikoerper, MISU antikoerper, MRT5 antikoerper, SAKI antikoerper, TRM4 antikoerper, RGD1311954 antikoerper, NOL1/NOP2/Sun domain family member 2 antikoerper, NOP2/Sun RNA methyltransferase family member 2 antikoerper, NOP2/Sun RNA methyltransferase family, member 2 antikoerper, NOP2/Sun RNA methyltransferase family member 2 S homeolog antikoerper, Nsun2 antikoerper, NSUN2 antikoerper, nsun2.S antikoerper

Hintergrund: Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).

Molekulargewicht: 86 kDa (MW of target protein)