CENPA Antikörper (Middle Region)

Produktnummer ABIN630727

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CENPA in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für CENPA Antikörper (Middle Region) (ABIN630727)

Target: CENPA (Centromere Protein A (CENPA))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CENPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CENPA Antikörper

Bindungsspezifität: Middle Region

Spezifität: CENPA antibody was raised against the middle region of CENPA

Aufreinigung: Affinity purified

Immunogen: CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENPA Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CENPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CENPA

Target: CENPA (Centromere Protein A (CENPA))

Andere Bezeichnung: CENPA

Hintergrund: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Chromatin Binding, Maintenance of Protein Location