CENPA Antikörper (N-Term)

Produktnummer ABIN629608

Produktdetails anti-CENPA Antikörper

Target: CENPA (Centromere Protein A (CENPA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CENPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CENPA antibody was raised against the N terminal of CENPA

Aufreinigung: Purified

Immunogen: CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENPA Blocking Peptide, catalog no. 33R-6060, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CENPA

Target: CENPA (Centromere Protein A (CENPA))

Andere Bezeichnung: CENPA (CENPA Produkte)

Synonyme: CENP-A antikoerper, CenH3 antikoerper, Cenp-A antikoerper, cenpx antikoerper, cenp-a antikoerper, sim2 antikoerper, Cenp-a antikoerper, RGD1563607 antikoerper, CENPA antikoerper, centromere protein A antikoerper, centromere protein-A antikoerper, centromeric histone-3 like protein antikoerper, centromere-specific histone H3 CENP-A antikoerper, cenp-A antikoerper, centromere protein A L homeolog antikoerper, histone H3-like centromeric protein A antikoerper, CENPA antikoerper, Cenpa antikoerper, CENP-A antikoerper, cenpa antikoerper, cenp-A antikoerper, cnp1 antikoerper, HAN_3g422 antikoerper, Cenp-a antikoerper, cenpa.L antikoerper, CMU_016480 antikoerper

Hintergrund: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Chromatin Binding, Maintenance of Protein Location