RORC Antikörper (N-Term)
-
- Target Alle RORC Antikörper anzeigen
- RORC (RAR-Related Orphan Receptor C (RORC))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RORC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RORC antibody was raised against the N terminal of RORC
- Aufreinigung
- Affinity purified
- Immunogen
- RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
- Top Product
- Discover our top product RORC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RORC Blocking Peptide, catalog no. 33R-2655, is also available for use as a blocking control in assays to test for specificity of this RORC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RORC (RAR-Related Orphan Receptor C (RORC))
- Andere Bezeichnung
- RORC (RORC Produkte)
- Synonyme
- NR1F3 antikoerper, RORG antikoerper, RZR-GAMMA antikoerper, RZRG antikoerper, TOR antikoerper, Nr1f3 antikoerper, RORgamma antikoerper, Thor antikoerper, RAR related orphan receptor C antikoerper, RAR-related orphan receptor C antikoerper, RAR-related orphan receptor gamma antikoerper, RORC antikoerper, Rorc antikoerper
- Hintergrund
- RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known, however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-