RORC Antikörper (N-Term)

Produktnummer ABIN630715

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RORC in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RORC Antikörper (N-Term) (ABIN630715)

Target: RORC (RAR-Related Orphan Receptor C (RORC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RORC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RORC Antikörper

Bindungsspezifität: N-Term

Spezifität: RORC antibody was raised against the N terminal of RORC

Aufreinigung: Affinity purified

Immunogen: RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RORC Blocking Peptide, (ABIN938041), is also available for use as a blocking control in assays to test for specificity of this RORC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RORC

Target: RORC (RAR-Related Orphan Receptor C (RORC))

Andere Bezeichnung: RORC

Hintergrund: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known, however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway