Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

H2AFY Antikörper (Middle Region)

Dieses Anti-H2AFY-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von H2AFY in WB. Geeignet für Human und Ratte.
Produktnummer ABIN630687

Kurzübersicht für H2AFY Antikörper (Middle Region) (ABIN630687)

Target

Alle H2AFY Antikörper anzeigen
H2AFY (H2A Histone Family, Member Y (H2AFY))

Reaktivität

  • 29
  • 21
  • 21
  • 5
  • 5
  • 4
  • 4
  • 4
  • 4
  • 3
  • 2
  • 2
  • 2
  • 1
  • 1
Human, Ratte

Wirt

  • 29
Kaninchen

Klonalität

  • 17
  • 12
Polyklonal

Konjugat

  • 22
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser H2AFY Antikörper ist unkonjugiert

Applikation

  • 22
  • 11
  • 8
  • 6
  • 5
  • 2
  • 2
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Middle Region

    Spezifität

    H2 AFY antibody was raised against the middle region of H2 FY

    Aufreinigung

    Affinity purified

    Immunogen

    H2 AFY antibody was raised using the middle region of H2 FY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    H2AFY Blocking Peptide, (ABIN5613917), is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    H2AFY (H2A Histone Family, Member Y (H2AFY))

    Andere Bezeichnung

    H2AFY

    Hintergrund

    Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

    Molekulargewicht

    39 kDa (MW of target protein)
Sie sind hier:
Chat with us!