SMUG1 Antikörper (Middle Region)

Produktnummer ABIN630668

Produktdetails anti-SMUG1 Antikörper

Target: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMUG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SMUG1 antibody was raised against the middle region of SMUG1

Aufreinigung: Affinity purified

Immunogen: SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMUG1

Target: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Andere Bezeichnung: SMUG1 (SMUG1 Produkte)

Synonyme: SMUG1 antikoerper, xsmug1 antikoerper, 1200013B09Rik antikoerper, A930006H09Rik antikoerper, C85220 antikoerper, FDG antikoerper, HMUDG antikoerper, UNG3 antikoerper, single-strand-selective monofunctional uracil-DNA glycosylase 1 antikoerper, single-strand selective monofunctional uracil DNA glycosylase antikoerper, single-strand-selective monofunctional uracil-DNA glycosylase 1 L homeolog antikoerper, SMUG1 antikoerper, smug1 antikoerper, smuG1 antikoerper, smuG antikoerper, LOC5577584 antikoerper, CpipJ_CPIJ002767 antikoerper, Smug1 antikoerper, smug1.L antikoerper

Hintergrund: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: DNA Reparatur