SMUG1 Antikörper (Middle Region)

Produktnummer ABIN630668

Der Kaninchen Polyklonal anti-SMUG1 Antikörper wird verwendet zum Nachweis von SMUG1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für SMUG1 Antikörper (Middle Region) (ABIN630668)

Target: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMUG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMUG1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SMUG1 antibody was raised against the middle region of SMUG1

Aufreinigung: Affinity purified

Immunogen: SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMUG1 Blocking Peptide, (ABIN939586), is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMUG1

Target: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Andere Bezeichnung: SMUG1

Hintergrund: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: DNA Reparatur