KPNA4 Antikörper

Produktnummer ABIN630664

Produktdetails anti-KPNA4 Antikörper

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Karyopherin Alpha 4 Blocking Peptide, catalog no. 33R-4568, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPNA4

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Andere Bezeichnung: Karyopherin alpha 4 (KPNA4 Produkte)

Synonyme: IPOA3 antikoerper, QIP1 antikoerper, SRP3 antikoerper, 6 antikoerper, ATIMPALPHA3 antikoerper, IMPA-3 antikoerper, IMPORTIN ALPHA 3 antikoerper, IMPORTIN ALPHA ISOFORM 3 antikoerper, MODIFIER OF SNC1 antikoerper, T10M13.16 antikoerper, T10M13_16 antikoerper, LOC100224013 antikoerper, 1110058D08Rik antikoerper, importin antikoerper, ipoa3 antikoerper, qip1 antikoerper, srp3 antikoerper, impa3 antikoerper, wu:fa56d07 antikoerper, wu:fa66g10 antikoerper, wu:fe14c04 antikoerper, wu:fi04h11 antikoerper, wu:fi19b05 antikoerper, karyopherin subunit alpha 4 antikoerper, ARM repeat superfamily protein antikoerper, importin alpha 3 antikoerper, karyopherin (importin) alpha 4 antikoerper, karyopherin alpha 4 (importin alpha 3) S homeolog antikoerper, karyopherin alpha 4 (importin alpha 3) antikoerper, KPNA4 antikoerper, MOS6 antikoerper, LOC100533341 antikoerper, Kpna4 antikoerper, kpna4.S antikoerper, kpna4 antikoerper

Hintergrund: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus