KPNA4 Antikörper

Produktnummer ABIN630664

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch KPNA4 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für KPNA4 Antikörper (ABIN630664)

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KPNA4 Antikörper

Aufreinigung: Affinity purified

Immunogen: Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Karyopherin Alpha 4 Blocking Peptide, (ABIN939954), is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPNA4

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Andere Bezeichnung: Karyopherin alpha 4

Hintergrund: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus