PDE1C Antikörper (Middle Region)

Produktnummer ABIN630646

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PDE1C in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für PDE1C Antikörper (Middle Region) (ABIN630646)

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDE1C Antikörper

Bindungsspezifität: Middle Region

Spezifität: PDE1 C antibody was raised against the middle region of PDE1

Aufreinigung: Affinity purified

Immunogen: PDE1 C antibody was raised using the middle region of PDE1 corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE1C Blocking Peptide, (ABIN939298), is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE1C

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Andere Bezeichnung: PDE1C

Hintergrund: Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma