KPNA6 Antikörper

Produktnummer ABIN630643

Produktdetails anti-KPNA6 Antikörper

Target: KPNA6 (Karyopherin alpha 6 (Importin alpha 7) (KPNA6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Karyopherin Alpha 6 Blocking Peptide, catalog no. 33R-8891, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPNA6

Target: KPNA6 (Karyopherin alpha 6 (Importin alpha 7) (KPNA6))

Andere Bezeichnung: Karyopherin alpha 6 (KPNA6 Produkte)

Synonyme: IPOA7 antikoerper, Kpna5 antikoerper, NPI-2 antikoerper, KPNA7 antikoerper, karyopherin subunit alpha 6 antikoerper, karyopherin (importin) alpha 6 antikoerper, karyopherin alpha 6 (importin alpha 7) antikoerper, karyopherin alpha 6 (importin alpha 7) S homeolog antikoerper, KPNA6 antikoerper, Kpna6 antikoerper, kpna6.S antikoerper

Hintergrund: The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus