Lamin B1 Antikörper (Middle Region)

Produktnummer ABIN630637

Produktdetails anti-Lamin B1 Antikörper

Target: Lamin B1 (LMNB1)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lamin B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lamin B1 antibody was raised against the middle region of LMNB1

Aufreinigung: Affinity purified

Immunogen: Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lamin B1 Blocking Peptide, catalog no. 33R-2393, is also available for use as a blocking control in assays to test for specificity of this Lamin B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lamin B1

Target: Lamin B1 (LMNB1)

Andere Bezeichnung: Lamin B1 (LMNB1 Produkte)

Synonyme: MGC52550 antikoerper, Lamin-L(I) antikoerper, lamin-b antikoerper, lmn antikoerper, lmn2 antikoerper, lmnb antikoerper, LMNB1 antikoerper, ADLD antikoerper, LMN antikoerper, LMN2 antikoerper, LMNB antikoerper, fc06g01 antikoerper, wu:fc06g01 antikoerper, lamin B1 L homeolog antikoerper, lamin B1 antikoerper, lmnb1.L antikoerper, lmnb1 antikoerper, LMNB1 antikoerper, Lmnb1 antikoerper

Hintergrund: LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: Apoptose, Caspase Kaskade in der Apoptose