GNAL Antikörper

Produktnummer ABIN630618

Dieses Anti-GNAL-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GNAL in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für GNAL Antikörper (ABIN630618)

Target: GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNAL Antikörper

Aufreinigung: Affinity purified

Immunogen: GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAL Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GNAL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAL

Target: GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))

Andere Bezeichnung: GNAL

Hintergrund: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Molekulargewicht: 50 kDa (MW of target protein)