TXNIP Antikörper (C-Term)
-
- Target Alle TXNIP Antikörper anzeigen
- TXNIP (Thioredoxin Interacting Protein (TXNIP))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TXNIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TXNIP antibody was raised against the C terminal of TXNIP
- Aufreinigung
- Affinity purified
- Immunogen
- TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP
- Top Product
- Discover our top product TXNIP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TXNIP Blocking Peptide, catalog no. 33R-2201, is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNIP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TXNIP (Thioredoxin Interacting Protein (TXNIP))
- Andere Bezeichnung
- TXNIP (TXNIP Produkte)
- Synonyme
- EST01027 antikoerper, HHCPA78 antikoerper, THIF antikoerper, VDUP1 antikoerper, Gm348 antikoerper, Trf3 antikoerper, TBP2 antikoerper, TRF3 antikoerper, 1200008J08Rik antikoerper, AA682105 antikoerper, Hyplip1 antikoerper, Tbp-2 antikoerper, Vdup1 antikoerper, sb:cb368 antikoerper, txnip antikoerper, thioredoxin interacting protein antikoerper, TATA box binding protein like 2 antikoerper, TATA-box binding protein like 2 antikoerper, thioredoxin interacting protein L homeolog antikoerper, thioredoxin interacting protein a antikoerper, TXNIP antikoerper, Tbpl2 antikoerper, TBPL2 antikoerper, Txnip antikoerper, txnip.L antikoerper, txnip antikoerper, txnipa antikoerper
- Hintergrund
- TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus, Platelet-derived growth Factor Receptor Signaling, Inflammasome
-