TXNIP Antikörper (C-Term)

Produktnummer ABIN630604

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TXNIP in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TXNIP Antikörper (C-Term) (ABIN630604)

Target: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TXNIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TXNIP Antikörper

Bindungsspezifität: C-Term

Spezifität: TXNIP antibody was raised against the C terminal of TXNIP

Aufreinigung: Affinity purified

Immunogen: TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TXNIP Blocking Peptide, (ABIN937587), is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TXNIP

Target: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Andere Bezeichnung: TXNIP

Hintergrund: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus, Platelet-derived growth Factor Receptor Signaling, Inflammasome