CRYBA1 Antikörper (N-Term)

Produktnummer ABIN630602

Der Kaninchen Polyklonal Anti-CRYBA1-Antikörper wurde für WB validiert. Er ist geeignet, CRYBA1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für CRYBA1 Antikörper (N-Term) (ABIN630602)

Target: CRYBA1 (Crystallin, beta A1 (CRYBA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRYBA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CRYBA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Crystallin Beta A1 antibody was raised against the N terminal of CRYBA1

Aufreinigung: Affinity purified

Immunogen: Crystallin Beta A1 antibody was raised using the N terminal of CRYBA1 corresponding to a region with amino acids METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Crystallin Beta A1 Blocking Peptide, (ABIN5613010), is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYBA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRYBA1

Target: CRYBA1 (Crystallin, beta A1 (CRYBA1))

Andere Bezeichnung: Crystallin beta A1

Hintergrund: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families, Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins.

Molekulargewicht: 25 kDa (MW of target protein)