H2AFX Antikörper (N-Term)

Produktnummer ABIN630601

Produktdetails anti-H2AFX Antikörper

Target: H2AFX (H2A Histone Family, Member X (H2AFX))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser H2AFX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: H2 AFX antibody was raised against the N terminal of H2 FX

Aufreinigung: Affinity purified

Immunogen: H2 AFX antibody was raised using the N terminal of H2 FX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

H2AFX Blocking Peptide, catalog no. 33R-8485, is also available for use as a blocking control in assays to test for specificity of this H2AFX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu H2AFX

Target: H2AFX (H2A Histone Family, Member X (H2AFX))

Andere Bezeichnung: H2AFX (H2AFX Produkte)

Synonyme: H2A.X antikoerper, H2A/X antikoerper, H2AX antikoerper, AW228881 antikoerper, H2ax antikoerper, Hist5-2ax antikoerper, gammaH2ax antikoerper, zgc:56329 antikoerper, h2a.x antikoerper, h2a/x antikoerper, h2ax antikoerper, RGD1566119 antikoerper, h2a antikoerper, h2afx antikoerper, H2A histone family member X antikoerper, H2A histone family, member X antikoerper, H2A histone family member X L homeolog antikoerper, histone cluster 1, H2ah antikoerper, histone cluster 2, H2ab S homeolog antikoerper, histone H2AX antikoerper, H2AFX antikoerper, H2afx antikoerper, h2afx antikoerper, h2afx.L antikoerper, HIST1H2AH antikoerper, hist2h2ab.S antikoerper, LOC100522201 antikoerper, LOC100720536 antikoerper

Hintergrund: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, Positive Regulation of Response to DNA Damage Stimulus