H2AFX Antikörper (N-Term)

Produktnummer ABIN630601

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch H2AFX in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für H2AFX Antikörper (N-Term) (ABIN630601)

Target: H2AFX (H2A Histone Family, Member X (H2AFX))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser H2AFX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-H2AFX Antikörper

Bindungsspezifität: N-Term

Spezifität: H2 AFX antibody was raised against the N terminal of H2 FX

Aufreinigung: Affinity purified

Immunogen: H2 AFX antibody was raised using the N terminal of H2 FX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

H2AFX Blocking Peptide, (ABIN5613915), is also available for use as a blocking control in assays to test for specificity of this H2AFX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu H2AFX

Target: H2AFX (H2A Histone Family, Member X (H2AFX))

Andere Bezeichnung: H2AFX

Hintergrund: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, Positive Regulation of Response to DNA Damage Stimulus