CKM Antikörper (N-Term)

Produktnummer ABIN630557

Der Kaninchen Polyklonal Anti-CKM-Antikörper wurde für WB validiert. Er ist geeignet, CKM in Proben von Human, Maus, Ratte und Hund zu detektieren. Es ist 1 Publikation verfügbar.

Kurzübersicht für CKM Antikörper (N-Term) (ABIN630557)

Target: CKM (Creatine Kinase, Muscle (CKM))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CKM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CKM Antikörper

Bindungsspezifität: N-Term

Spezifität: CKMM antibody was raised against the N terminal of CKM

Aufreinigung: Affinity purified

Immunogen: CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CKMM Blocking Peptide, catalog no. 33R-9549, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-CKM Antikörper (ABIN630557)

Mihm, Yu, Reiser, Bauer: "Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).

Details zu CKM

Target: CKM (Creatine Kinase, Muscle (CKM))

Andere Bezeichnung: CKMM

Hintergrund: CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart.

Molekulargewicht: 43 kDa (MW of target protein)