Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

CKM Antikörper (Creatine Kinase, Muscle) (AA 282-381) Primary Antibody

CKM Reaktivität: Human IF, ELISA, WB Wirt: Maus Monoclonal 1E3 unconjugated
Produktnummer ABIN560386
$524.00
Zzgl. Versandkosten $45.00
100 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    CKM
    Bindungsspezifität
    AA 282-381
    • 21
    • 15
    • 11
    • 11
    • 8
    • 8
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 139
    • 53
    • 40
    • 9
    • 8
    • 6
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    Wirt
    Maus
    • 112
    • 27
    • 22
    • 1
    Klonalität
    Monoklonal
    • 134
    • 27
    Konjugat
    Dieser CKM Antikörper ist unkonjugiert
    • 72
    • 27
    • 16
    • 11
    • 8
    • 8
    • 7
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Applikation
    Immunofluorescence (IF), ELISA, Western Blotting (WB)
    • 111
    • 89
    • 49
    • 15
    • 15
    • 13
    • 12
    • 10
    • 10
    • 9
    • 8
    • 8
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Verwendungszweck
    Mouse monoclonal antibody raised against a partial recombinant CKM.
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

    Klon
    1E3
    Isotyp
    IgG1 kappa
  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    In 1x PBS, pH 7.4
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CKM
    Andere Bezeichnung
    CKM (CKM Antibody Abstract)
    Synonyme
    CKMM, M-CK, Ckmm, MCK, ckmm, m-ck, CKM, CK-M, cb51, ckm, mck, wu:fa28d05, ckm3, wu:fb55e09, zgc:64204, zgc:92070, creatine kinase, M-type, creatine kinase, muscle, creatine kinase, M-type L homeolog, creatine kinase, muscle a, creatine kinase, muscle b, CKM, Ckm, ckm.L, ckm, ckma, ckmb
    Hintergrund
    Full Gene Name: creatine kinase, muscle
    Synonyms: CKMM,M-CK
    Gen-ID
    1158
    NCBI Accession
    NP_001815, NM_001824
Sie sind hier:
help Kundenservice