IL13RA2 Antikörper (N-Term)

Produktnummer ABIN630522

Dieses Anti-IL13RA2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IL13RA2 in WB. Geeignet für Human und Hund.

Kurzübersicht für IL13RA2 Antikörper (N-Term) (ABIN630522)

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL13RA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL13RA2 Antikörper

Bindungsspezifität: N-Term

Spezifität: IL13 RA2 antibody was raised against the N terminal of IL13 A2

Aufreinigung: Affinity purified

Immunogen: IL13 RA2 antibody was raised using the N terminal of IL13 A2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL13RA2 Blocking Peptide, (ABIN937359), is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL13RA2

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Andere Bezeichnung: IL13RA2

Hintergrund: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Molekulargewicht: 22 kDa (MW of target protein)