Vitamin D Receptor Antikörper (N-Term)

Produktnummer ABIN630503

Produktdetails anti-Vitamin D Receptor Antikörper

Target: Vitamin D Receptor (VDR)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Vitamin D Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VDR antibody was raised against the N terminal of VDR

Aufreinigung: Affinity purified

Immunogen: VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VDR Blocking Peptide, catalog no. 33R-4052, is also available for use as a blocking control in assays to test for specificity of this VDR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Vitamin D Receptor

Target: Vitamin D Receptor (VDR)

Andere Bezeichnung: VDR (VDR Produkte)

Synonyme: vdrbeta antikoerper, vdr0 antikoerper, LOC100136219 antikoerper, NR1I1-B antikoerper, gb:dq017633 antikoerper, vdr-b antikoerper, Ci-VDR-b antikoerper, VDR antikoerper, LOC100221284 antikoerper, vdr-A antikoerper, xVDR antikoerper, Nr1i1 antikoerper, vdr antikoerper, NR1I1 antikoerper, PPP1R163 antikoerper, vitamin D (1,25- dihydroxyvitamin D3) receptor antikoerper, vitamin D receptor antikoerper, vitamin D3 receptor A antikoerper, vitamin D receptor b antikoerper, nuclear receptor VDR-b antikoerper, vitamin D (1,25- dihydroxyvitamin D3) receptor L homeolog antikoerper, vitamin D (1,25-dihydroxyvitamin D3) receptor antikoerper, vitamin D receptor a antikoerper, vdr antikoerper, vdr0 antikoerper, VDR antikoerper, LOC100136219 antikoerper, vdrb antikoerper, vdr-b antikoerper, vdr.L antikoerper, Vdr antikoerper, vdra antikoerper

Substanzklasse: Chemical

Hintergrund: VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway