Vitamin D Receptor Antikörper (N-Term)

Produktnummer ABIN630503

Der Kaninchen Polyklonal Anti-Vitamin D Receptor-Antikörper wurde für WB validiert. Er ist geeignet, Vitamin D Receptor in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Vitamin D Receptor Antikörper (N-Term) (ABIN630503)

Target: Vitamin D Receptor (VDR)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Vitamin D Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Vitamin D Receptor Antikörper

Bindungsspezifität: N-Term

Spezifität: VDR antibody was raised against the N terminal of VDR

Aufreinigung: Affinity purified

Immunogen: VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VDR Blocking Peptide, (ABIN939438), is also available for use as a blocking control in assays to test for specificity of this VDR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Vitamin D Receptor

Target: Vitamin D Receptor (VDR)

Andere Bezeichnung: VDR

Substanzklasse: Chemical

Hintergrund: VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway