Retinoid X Receptor gamma Antikörper (N-Term)
-
- Target Alle Retinoid X Receptor gamma (RXRG) Antikörper anzeigen
- Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Retinoid X Receptor gamma Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RXRG antibody was raised against the N terminal of RXRG
- Aufreinigung
- Affinity purified
- Immunogen
- RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH
- Top Product
- Discover our top product RXRG Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))
- Andere Bezeichnung
- RXRG (RXRG Produkte)
- Synonyme
- NR2B3 antikoerper, RXRC antikoerper, zgc:92183 antikoerper, RXRgamma antikoerper, RXRG antikoerper, RXR-gamma antikoerper, nr2b3 antikoerper, xrxrg antikoerper, rxrc antikoerper, Nr2b3 antikoerper, NR2B1 antikoerper, RXR antikoerper, rxra antikoerper, rxrg antikoerper, retinoid X receptor gamma antikoerper, retinoid X receptor, gamma b antikoerper, retinoid X receptor gamma L homeolog antikoerper, retinoid x receptor, gamma a antikoerper, RXRG antikoerper, rxrgb antikoerper, rxrg.L antikoerper, rxrg antikoerper, Rxrg antikoerper, RXRGAMMA antikoerper, rxrga antikoerper
- Hintergrund
- RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-