Retinoid X Receptor gamma Antikörper (N-Term)

Produktnummer ABIN630498

Dieses Anti-Retinoid X Receptor gamma-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Retinoid X Receptor gamma in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Retinoid X Receptor gamma Antikörper (N-Term) (ABIN630498)

Target: Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoid X Receptor gamma Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Retinoid X Receptor gamma Antikörper

Bindungsspezifität: N-Term

Spezifität: RXRG antibody was raised against the N terminal of RXRG

Aufreinigung: Affinity purified

Immunogen: RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RXRG Blocking Peptide, (ABIN5615985), is also available for use as a blocking control in assays to test for specificity of this RXRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoid X Receptor gamma

Target: Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))

Andere Bezeichnung: RXRG

Hintergrund: RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway