Retinoid X Receptor alpha Antikörper (C-Term)
-
- Target Alle Retinoid X Receptor alpha (RXRA) Antikörper anzeigen
- Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Retinoid X Receptor alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RXRA antibody was raised against the C terminal of RXRA
- Aufreinigung
- Affinity purified
- Immunogen
- RXRA antibody was raised using the C terminal of RXRA corresponding to a region with amino acids MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ
- Top Product
- Discover our top product RXRA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RXRA Blocking Peptide, catalog no. 33R-5845, is also available for use as a blocking control in assays to test for specificity of this RXRA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))
- Andere Bezeichnung
- RXRA (RXRA Produkte)
- Synonyme
- NR2B1 antikoerper, 9530071D11Rik antikoerper, Nr2b1 antikoerper, RXRalpha1 antikoerper, RXRalpha antikoerper, rxra-A antikoerper, xRXR alpha antikoerper, xrxra antikoerper, RXRA antikoerper, RXR alpha antikoerper, etID309731.5 antikoerper, rxr antikoerper, rxra antikoerper, rxrg antikoerper, RXRalpha-B antikoerper, retinoid X receptor alpha antikoerper, retinoid X receptor alpha L homeolog antikoerper, retinoid x receptor, alpha b antikoerper, retinoid X receptor, alpha a antikoerper, RXRA antikoerper, Rxra antikoerper, rxra.L antikoerper, CpipJ_CPIJ010249 antikoerper, rxrab antikoerper, rxraa antikoerper
- Hintergrund
- Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C
-