Retinoid X Receptor alpha Antikörper (N-Term)

Produktnummer ABIN630495

Produktdetails anti-Retinoid X Receptor alpha Antikörper

Target: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoid X Receptor alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RXRA antibody was raised against the N terminal of RXRA

Aufreinigung: Affinity purified

Immunogen: RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RXRA Blocking Peptide, catalog no. 33R-2196, is also available for use as a blocking control in assays to test for specificity of this RXRA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoid X Receptor alpha

Target: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Andere Bezeichnung: RXRA (RXRA Produkte)

Synonyme: NR2B1 antikoerper, 9530071D11Rik antikoerper, Nr2b1 antikoerper, RXRalpha1 antikoerper, RXRalpha antikoerper, rxra-A antikoerper, xRXR alpha antikoerper, xrxra antikoerper, RXRA antikoerper, RXR alpha antikoerper, etID309731.5 antikoerper, rxr antikoerper, rxra antikoerper, rxrg antikoerper, RXRalpha-B antikoerper, retinoid X receptor alpha antikoerper, retinoid X receptor alpha L homeolog antikoerper, retinoid x receptor, alpha b antikoerper, retinoid X receptor, alpha a antikoerper, RXRA antikoerper, Rxra antikoerper, rxra.L antikoerper, CpipJ_CPIJ010249 antikoerper, rxrab antikoerper, rxraa antikoerper

Hintergrund: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C