Retinoid X Receptor alpha Antikörper (N-Term)

Produktnummer ABIN630495

Dieses Anti-Retinoid X Receptor alpha-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Retinoid X Receptor alpha in WB. Geeignet für Human.

Kurzübersicht für Retinoid X Receptor alpha Antikörper (N-Term) (ABIN630495)

Target: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoid X Receptor alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Retinoid X Receptor alpha Antikörper

Bindungsspezifität: N-Term

Spezifität: RXRA antibody was raised against the N terminal of RXRA

Aufreinigung: Affinity purified

Immunogen: RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RXRA Blocking Peptide, (ABIN937582), is also available for use as a blocking control in assays to test for specificity of this RXRA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoid X Receptor alpha

Target: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Andere Bezeichnung: RXRA

Hintergrund: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C