Melanoma gp100 Antikörper

Produktnummer ABIN630469

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Melanoma gp100 in IHC und WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für Melanoma gp100 Antikörper (ABIN630469)

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Melanoma gp100 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-Melanoma gp100 Antikörper

Aufreinigung: Purified

Immunogen: SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SILV Blocking Peptide, (ABIN939113), is also available for use as a blocking control in assays to test for specificity of this SILV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Melanoma gp100

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Andere Bezeichnung: SILV

Hintergrund: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Molekulargewicht: 70 kDa (MW of target protein)