M6PR Antikörper

Produktnummer ABIN630460

Produktdetails anti-M6PR Antikörper

Target: M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser M6PR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

M6PR Blocking Peptide, catalog no. 33R-8035, is also available for use as a blocking control in assays to test for specificity of this M6PR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of M0 R antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu M6PR

Target: M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))

Andere Bezeichnung: M6PR (M6PR Produkte)

Synonyme: CD222 antikoerper, CIMPR antikoerper, M6P-R antikoerper, MPR1 antikoerper, MPRI antikoerper, CD-MPR antikoerper, MPR 46 antikoerper, MPR-46 antikoerper, MPR46 antikoerper, SMPR antikoerper, Mpr46 antikoerper, CDMPR antikoerper, m6pr antikoerper, MGC68896 antikoerper, MGC130765 antikoerper, zgc:77757 antikoerper, wu:fj81h11 antikoerper, MGC89423 antikoerper, M6PR antikoerper, mprd antikoerper, C16orf27 antikoerper, GNPTAG antikoerper, LP2537 antikoerper, RJD9 antikoerper, insulin like growth factor 2 receptor antikoerper, mannose-6-phosphate receptor, cation dependent antikoerper, mannose-6-phosphate receptor (cation dependent) L homeolog antikoerper, mannose-6-phosphate receptor (cation dependent) antikoerper, mannose-6-phosphate receptor (cation dependent) S homeolog antikoerper, Cation-dependent mannose-6-phosphate receptor antikoerper, N-acetylglucosamine-1-phosphate transferase gamma subunit antikoerper, IGF2R antikoerper, M6PR antikoerper, M6pr antikoerper, m6pr.L antikoerper, m6pr antikoerper, m6pr.S antikoerper, Ethha_1678 antikoerper, mprd antikoerper, GNPTG antikoerper

Hintergrund: M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.

Molekulargewicht: 28 kDa (MW of target protein)