NEU1 Antikörper
-
- Target Alle NEU1 Antikörper anzeigen
- NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NEU1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
- Top Product
- Discover our top product NEU1 Primärantikörper
-
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 47-415) antibody
NEU1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 48-315) antibodyNEU1 Reaktivität: Human WB, IHC, IHC (p) Wirt: Maus Monoclonal 3D4 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 334-415) antibodyNEU1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3F9 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 11-40) antibodyNEU1 Reaktivität: Human WB, IHC, ELISA, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 201-415) antibodyNEU1 Reaktivität: Human IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 11-40) antibodyNEU1 Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB18511 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 188-214) antibodyNEU1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB42166 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 334-415) antibodyNEU1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (Internal Region) antibodyNEU1 Reaktivität: Human WB, ELISA, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 156-415) antibodyNEU1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NEU1 Blocking Peptide, catalog no. 33R-9913, is also available for use as a blocking control in assays to test for specificity of this NEU1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))
- Andere Bezeichnung
- NEU1 (NEU1 Produkte)
- Synonyme
- NANH antikoerper, NEU antikoerper, SIAL1 antikoerper, MGC81958 antikoerper, AA407268 antikoerper, AA407316 antikoerper, Aglp antikoerper, Apl antikoerper, Bat-7 antikoerper, Bat7 antikoerper, G9 antikoerper, Map-2 antikoerper, Neu antikoerper, Neu-1 antikoerper, neuraminidase 1 antikoerper, neuraminidase 1 (lysosomal sialidase) L homeolog antikoerper, NEU1 antikoerper, neu1.L antikoerper, neu1 antikoerper, Neu1 antikoerper
- Hintergrund
- NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
