LCAT Antikörper (N-Term)

Produktnummer ABIN630433

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LCAT in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für LCAT Antikörper (N-Term) (ABIN630433)

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LCAT Antikörper

Bindungsspezifität: N-Term

Spezifität: LCAT antibody was raised against the N terminal of LCAT

Aufreinigung: Purified

Immunogen: LCAT antibody was raised using the N terminal of LCAT corresponding to a region with amino acids MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LCAT Blocking Peptide, (ABIN5614425), is also available for use as a blocking control in assays to test for specificity of this LCAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCAT

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Andere Bezeichnung: LCAT

Hintergrund: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Lipid Metabolism