Glucuronidase beta Antikörper (C-Term)
-
- Target Alle Glucuronidase beta (GUSB) Antikörper anzeigen
- Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Glucuronidase beta Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GUSB antibody was raised against the C terminal of GUSB
- Aufreinigung
- Purified
- Immunogen
- GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
- Top Product
- Discover our top product GUSB Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GUSB Blocking Peptide, catalog no. 33R-9662, is also available for use as a blocking control in assays to test for specificity of this GUSB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))
- Andere Bezeichnung
- GUSB (GUSB Produkte)
- Hintergrund
- GUSB plays an important role in the degradation of dermatan and keratan sulfates.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-