Glucuronidase beta Antikörper (C-Term)

Produktnummer ABIN630431

Der Kaninchen Polyklonal Anti-Glucuronidase beta-Antikörper wurde für WB und IHC validiert. Er ist geeignet, Glucuronidase beta in Proben von Human zu detektieren.

Kurzübersicht für Glucuronidase beta Antikörper (C-Term) (ABIN630431)

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glucuronidase beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Glucuronidase beta Antikörper

Bindungsspezifität: C-Term

Spezifität: GUSB antibody was raised against the C terminal of GUSB

Aufreinigung: Purified

Immunogen: GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GUSB Blocking Peptide, (ABIN5613911), is also available for use as a blocking control in assays to test for specificity of this GUSB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glucuronidase beta

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Andere Bezeichnung: GUSB

Hintergrund: GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process