FGG Antikörper (Middle Region)

Produktnummer ABIN630420

Produktdetails anti-FGG Antikörper

Target: FGG (Fibrinogen gamma Chain (FGG))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FGG antibody was raised against the middle region of FGG

Aufreinigung: Purified

Immunogen: FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FGG Blocking Peptide, catalog no. 33R-8054, is also available for use as a blocking control in assays to test for specificity of this FGG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FGG

Target: FGG (Fibrinogen gamma Chain (FGG))

Andere Bezeichnung: FGG (FGG Produkte)

Synonyme: FXII antikoerper, HAF antikoerper, 3010002H13Rik antikoerper, AI256424 antikoerper, fibrinogen antikoerper, FGG antikoerper, LOC100220680 antikoerper, fb60h05 antikoerper, fb62e01 antikoerper, wu:fb60h05 antikoerper, wu:fb62e01 antikoerper, zgc:56023 antikoerper, fibrinogen gamma chain antikoerper, coagulation factor XII (Hageman factor) antikoerper, fibrinogen gamma chain L homeolog antikoerper, FGG antikoerper, F12 antikoerper, fgg antikoerper, Fgg antikoerper, fgg.L antikoerper, CpipJ_CPIJ006387 antikoerper, CpipJ_CPIJ010087 antikoerper

Hintergrund: FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.

Molekulargewicht: 46 kDa (MW of target protein)