Aspartate beta Hydroxylase Antikörper (N-Term)

Produktnummer ABIN630417

Produktdetails anti-Aspartate beta Hydroxylase Antikörper

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aspartate beta Hydroxylase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ASPH antibody was raised against the N terminal of ASPH

Aufreinigung: Purified

Immunogen: ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASPH Blocking Peptide, catalog no. 33R-8411, is also available for use as a blocking control in assays to test for specificity of this ASPH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aspartate beta Hydroxylase

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Andere Bezeichnung: ASPH (ASPH Produkte)

Synonyme: AAH antikoerper, BAH antikoerper, CASQ2BP1 antikoerper, HAAH antikoerper, JCTN antikoerper, junctin antikoerper, 2310005F16Rik antikoerper, 3110001L23Rik antikoerper, AI848629 antikoerper, AW261690 antikoerper, AW561901 antikoerper, C79816 antikoerper, cI-37 antikoerper, aah antikoerper, bah antikoerper, jctn antikoerper, MGC107896 antikoerper, cb971 antikoerper, fb69e10 antikoerper, fc06d04 antikoerper, fc95a08 antikoerper, wu:fb69e10 antikoerper, wu:fc06d04 antikoerper, wu:fc95a08 antikoerper, aspartate beta-hydroxylase antikoerper, aspartate-beta-hydroxylase antikoerper, aspartate beta-hydroxylase L homeolog antikoerper, ASPH antikoerper, Asph antikoerper, asph antikoerper, asph.L antikoerper

Hintergrund: ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity