MAS1 Antikörper (Middle Region)
-
- Target Alle MAS1 Antikörper anzeigen
- MAS1 (MAS1 Oncogene (MAS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MAS1 antibody was raised against the middle region of MAS1
- Aufreinigung
- Purified
- Immunogen
- MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
- Top Product
- Discover our top product MAS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAS1 Blocking Peptide, catalog no. 33R-8095, is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAS1 (MAS1 Oncogene (MAS1))
- Andere Bezeichnung
- MAS1 (MAS1 Produkte)
- Synonyme
- MAS antikoerper, Mas-1 antikoerper, c-mas antikoerper, MAS1 antikoerper, MAS1 proto-oncogene, G protein-coupled receptor antikoerper, MAS1 oncogene antikoerper, proto-oncogene Mas antikoerper, MAS1 antikoerper, Mas1 antikoerper, LOC703105 antikoerper
- Hintergrund
- The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process
-