MAS1 Antikörper (Middle Region)

Produktnummer ABIN630411

Produktdetails anti-MAS1 Antikörper

Target: MAS1 (MAS1 Oncogene (MAS1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MAS1 antibody was raised against the middle region of MAS1

Aufreinigung: Purified

Immunogen: MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAS1 Blocking Peptide, catalog no. 33R-8095, is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAS1

Target: MAS1 (MAS1 Oncogene (MAS1))

Andere Bezeichnung: MAS1 (MAS1 Produkte)

Synonyme: MAS antikoerper, Mas-1 antikoerper, c-mas antikoerper, MAS1 antikoerper, MAS1 proto-oncogene, G protein-coupled receptor antikoerper, MAS1 oncogene antikoerper, proto-oncogene Mas antikoerper, MAS1 antikoerper, Mas1 antikoerper, LOC703105 antikoerper

Hintergrund: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process