TGFBI Antikörper (C-Term)

Produktnummer ABIN630399

Der Kaninchen Polyklonal anti-TGFBI Antikörper (ABIN630399) detektiert spezifisch TGFBI in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für TGFBI Antikörper (C-Term) (ABIN630399)

Target: TGFBI (Transforming Growth Factor, beta-Induced, 68kDa (TGFBI))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGFBI Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TGFBI Antikörper

Bindungsspezifität: C-Term

Spezifität: TGFBI antibody was raised against the C terminal of TGFBI

Aufreinigung: Purified

Immunogen: TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGFBI Blocking Peptide, (ABIN940480), is also available for use as a blocking control in assays to test for specificity of this TGFBI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFBI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGFBI

Target: TGFBI (Transforming Growth Factor, beta-Induced, 68kDa (TGFBI))

Andere Bezeichnung: TGFBI

Hintergrund: TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.

Molekulargewicht: 46 kDa (MW of target protein)